image description


Wow Really? Really?
  Forum Index » Studio One General Discussion 
Author
Message
illumin
Presonic
[Avatar]

Joined: 19/03/2011 21:53:35
Messages: 547
Location: Long Beach, CA
Offline

eike wrote:i thought studio one artist was the software that came for free with your hardware? i recommend trying it out before complaining.


priceless!!
MAC: MBP i7 (quad) 2.0 Lion (early 2011)
Audio: Focusrite Saffire Pro 40 | TonePortUX2 | MBox2 Mini

Soft: S1v2.6.2 | Cubase 6.5 | Live 8 | various plugs
Hard: M-Audio Axiom 61 (1st gen) & O2 & Mini32

Toys: ESP LTD EC-1000 | Schecter Tempest Custom | Gibson LP Studio | Epiphone MIC LP & T+ | Blackstar Ht-5R & HTV112 | Vox VT20+ | Dean Custom Zone Green Bass | Yamaha P95 | NI Maschine mk2 | Waldorf Pulse 2
hibidy
Presonoid

Joined: 01/02/2011 09:13:29
Messages: 2320
Offline

total drive-by
New computer:

2.6.2/win7x64 ultimate/SSD os and library/i7 4770/16GB ram

Focusrite saffire 14/Novation impulse 49/tons of VST goodies

Dawfreak
Presonic
[Avatar]

Joined: 17/10/2011 00:04:25
Messages: 145
Offline

Texas Willie wrote:
Daw stew wrote:Welcome back godparticle


LOL....Error 37!

TW


Indeed.... E R R O R 3 7!!!!

This message was edited 1 time. Last update was at 31/05/2013 00:15:49

"Just because you ain't paranoid i doesn't mean they're not out to get you"

System!
Ultra quiet PC Asus p8z77-v lx, I5 3570K, SAPPHIRE HD 7750 ULTIMATE, 480gb Seagat SSD 600 system drive, 1 TB velociraptor File disk, 16 ggb corsair DDR3, Fractal Design Define R4 case.
Windows 8 Runing S1 for all my testings and productions.

PreSonus FIRESTUDIO mobile.
[WWW]
moraldecay31
Presonic
[Avatar]

Joined: 19/12/2011 01:59:50
Messages: 286
Location: Addison,IL (west suburbs of chicago)
Offline

What type if interface is it that won't work properly with artist. You are very vague on your rant
Desktop HP Pavillion 14GB RAM 1 Terrabyte Hard drive,Windows 7 64 bit, Studio One PRO 2.6, fostex studio monitors,Presonus Eris E8, Presonus Studio Live 16.0.2, Presonus Firestudio Project, Presonus Monitor Station,Presonus Faderport, Presonus HD7 Headphones, fostex vm200 control surface,Line 6 pod x3 live,bass pod, and hd147 amp head, ampeg vh140c head,alesis dm5, Casio MIDI keyboard, yamaha double bass 7 piece drum kit,Audix drum mics, Rode NT1A, MXL, Samson, and CAD mics,ESP guitars, and much much more
[WWW]
allrics
Prenoob

Joined: 14/06/2011 20:24:38
Messages: 25
Offline

Studio One Pro 2.0 64 bit
AudioBox 1818
Win 7 Ultimate 64 bit
ASUS/Sabertooth 999FX Motherboard
AMD 8-Core 4.0G
SSD 256G Samsung
1 TB HD
woodbeast
Presonic
[Avatar]

Joined: 30/01/2011 22:05:34
Messages: 267
Offline

Wow What a 8==================>
Studio One Pro V2 Newest Build
Roland Quad Capture
PreSonus HP4
Win7 Pro 64 bit
Intel i5 @3.30Ghz
Asus P8P67 Pro Radeon HD5770
12 gig Ram
2 7200 WD Black Drives
Dedicated box to SP1 V2 only
Plugins: Amplitude, Harmony EFX , Melodyne Editor,SampleTank 2,5XL,EZ Keys, Superior Drummer, EX Mix, Ozone Studio etc
MPK 49 Connected via USB
[Email]
HamKent
Prenoob

Joined: 06/10/2012 14:50:14
Messages: 57
Location: Newcastle, Australia
Offline

cant say i know anyone who has joined a forum just for the purpose of complaining

troll maybe???
infinitoar
Prenoob
[Avatar]

Joined: 18/06/2012 22:18:39
Messages: 73
Location: Wouldn't you like to know?
Offline

Ok let's break this down shall we?

"You sell a program for 100 dollars and don't offer plugin support"

-Anyone who buys something, does extensive research 1st and foremost. That's like buying a used car[or even a BRAND NEW ONE] and not seeing what features come with the car, and the history of it, plus comparing prices and features of other competing vehicles. Obviously you didn't do ANY research and on top of that did not see what features were enabled or not. So I take it you're the type of person who buys food, with certain mixed in ingredients that you could be possibly allergic to, and then eat it, and then complain when you have a serious allergic attack.

"Even Audacity has that and that's free, same with Reaper."

-Audacity isn't a DAW for one, and 2 Reaper isn't FREE. Once you past the evaluation date you are technically ILLEGALLY using the software. Just so you know...

"In other words you want me to shell out an additional 300 hundred dollars so that I can use my interface properly?"
-I spent 250$ and got a Audiobox USB/damn good condenser mic/Badass Studio headphones/a cool sticker/some rubber thingy I don't know what's it for[lol]/and Studio One V2 Artist, WITH, the upgrade path to professional for 100$. If you ask me PreSonus is being freaking kind as hell doing that, and LOSING OUT on money.[in my opinion, but hey, they're nice people and I'm glad for that] And you don't have to spend another 300 dollars IF. YOU. DID. SOME. RESEARCH. BEFORE. BUYING.

"That's incredibly ridiculous not to mention greedy."
-I started out using:
-Audacity[Free]
-Reaper[until the 32nd day then I stopped. This is when they had the 30 day period.]
-Podium Free[the free version, that is totally legal, free, but has limitations I don't like. Plus missing features, but to me it's the most stable free DAW out there to get started on to save money and "then do research on the DAW that I would need before buying it". Did I mention I did research before buying it? I think I did..]
-Saved enough dough to buy a DAW. Did "some research" and after my teacher who taught me music[Paul Udarov] said to get the audiobox USB, after much deliberation I decided to do it, knowing that Artist is limited. Used Podium Free for about 2 more weeks and spent 100 bucks on the upgrade path. Haven't regretted it since. Because I did research before I bought it. Did I mention I did research before buying it? Oh yeah, I did.

And they're not greedy, as I said buying the Audiobox then the 99$ upgrade path was cheap[and very generous] to me. And I'm a CHEAPO and I also waited until they had the Christmas sale where upgrading to the final "professional version" was only 119!!! So all in all I spent....ooohh let's see...470$ rounded to the nearest 10? Yeah. So PreSonus is more GENEROUS and CHEAP to their customers than GREEDY. I don't know where you're getting this from but please reconsider your "rage" on something else.

"Bottom line. I'm not a producer, I don't own a studio, I don't have 300 dollars to just throw at a program."

-Neither am I, nor do I "own a studio either". I worked at a PART-TIME MALL JOB. Busted my ASS to save what little I could and PreSonus was kind enough to offer numerous occasional discounts to those interested. And I was INTERESTED.[Because I'm a cheapo, lol] I didn't have 300$ to "throw at a program", but I saved up, and gave them whatever I could if I had it, and it just so happens I had it because of GENEROUS DISCOUNTS TO THOSE INTERESTED. Stop bashing them so much, maybe deep down, you know it's your own fault, yet you vent at them for your own mistakes, which is wrong. And I'm sure if you asked them kindly and generously and RESPECTFULLY gave them a "letter of concern", they could either refund you or find a way to accommodate for your trouble. But if you're going to be a jerk, then I wouldn't want to help you either, whether I was a company or not.

"I'm a musician, I need software for recording and making a few touches here and there, to do this I need the basic plugins my interface comes with, you know the ones that I actually know how to use because I don't have the time or the care to mess with all the other crap."

-You're a musician. HA! A "real musician" uses whatever tools they are given and makes the best of it. A "real" musician gives 110% effort, sacrifice, and hard work to whatever he/she is striving for to obtain it. "I" worked at a part-time MALL JOB[Mall jobs SUCK by the way] and I got the full software due to patience, understanding, research, discounts, and "The Will to Be".[It's the name of my debut album....see what I did there?] You're calling yourself a "musician"? Please. Don't offend me again.[and others out there who are "real" musicians]

"Well thanks for nothing, thank god I don't have anymore of your products, you seem like the type of company that would make the costumer buy the inputs and dials for their interface separately."

-Thanks for "nothing"? If what YOU messed up on is nothing, then so be it. You don't have their amazing products anymore? Ok, cool. But- YOU seem like the type who[like I said] would go to a store, buy something with a ingredient in it that you're allergic to, not CHECK it, EAT it, break out or have a allergic attack, and then complain to the company it had something in it that you KNOWINGLY was allergic TO. /facepalmheadesksmashesheadwithguitar

"Sincerely,
Your Biggest Fan"

-You're not a fan. You're a gnikcuf idiot who thinks trolling a great company like PreSonus will make them bow down to you and also make them give you whatever you want, or what you would "consider a reimbursement".

Goodbye.

This message was edited 3 times. Last update was at 31/05/2013 06:43:48

Audio PC specs:
Intel Core i5-3570K Ivy Bridge||Corsair 600watt "Semi-Modular" PSU||G.SKILL Ripjaws Series 8GB (2 x 4GB) 240-Pin DDR3 SDRAM DDR3 1333||ASUS 24X DVD Burner OEM||MSI Z77A-G41 LGA 1155||COOLER MASTER Hyper 212 Plus||Rosewill CHALLENGER-U3 Black Gaming ATX Mid Tower Computer Case||RAZER Naga Molten Black Mouse||Razer Deathstalker "Expert" Keyboard||160GB Western Digital Blue Caviar 3Gb/s 5400 RPM drive & Seagate 1TB||PreSonus Audiobox USB Bundle||Windows 7 Home Premium 64bit||Schecter Omen 6 Walnut Stain||Fender Squier J-Bass||Acer 23' HDMI monitor||EVGA GTX 650Ti SSC BOOST

Till next time.
www.soundcloud.com/greygscot
thunderkyss
Prenoob

Joined: 16/04/2013 16:10:26
Messages: 40
Offline

eike wrote:i thought studio one artist was the software that came for free with your hardware? i recommend trying it out before complaining.


That's if he bought presonus hardware. If he paid $100 for S1Artist, he didn't buy presonus hardware.

Either way, it should only be $100 to upgrade to the Producer version, but it's not explained in a straight forward way on their site.... when you register.

But I do agree with the original poster. No VST/ReWire support is odd & not the norm for this industry. Most other DAWs will give you VST & ReWire support, but limit your track count, sends, effect slots, inputs & outputs.

As a musician I can live with those limitations much easier than I can without VST/ReWire support. I bought Komplete8 & can't use it with S1. I could upgrade for $99 to add that functionality, but it's much easier to use AbletonLite8 (which I got free with my MBox2Pro along with ProTools 7.4), or ProTools10 (which I got with my ElevenRack), or MagixMusicStudio (which I can buy for $50)

This message was edited 1 time. Last update was at 31/05/2013 07:21:14

hibidy
Presonoid

Joined: 01/02/2011 09:13:29
Messages: 2320
Offline

HamKent wrote:cant say i know anyone who has joined a forum just for the purpose of complaining

troll maybe???




Like I said, total drive-by
New computer:

2.6.2/win7x64 ultimate/SSD os and library/i7 4770/16GB ram

Focusrite saffire 14/Novation impulse 49/tons of VST goodies

eike
Preamp
[Avatar]

Joined: 16/04/2009 10:27:02
Messages: 1655
Offline

he got an artist *bundle* license. wherever and whyever. (which is really all i wanted to contribute here, but then nowhere there is as much sociability as with a solid lynching). i he had not i'd agree to the drive-by trolling. here i 'd say the guy smelled a free lunch, but only got the roadkill. couldn't resist. kill the witch.
cristofe
Presonificator
[Avatar]

Joined: 12/03/2012 21:10:44
Messages: 3628
Location: Skaneateles, NY USA
Offline

the guy smelled a free lunch, but only got the roadkill.


Don't knock it till you've tried it.....LOL!!


PC'S: HP XW6000 Dual 3.2GHz Intel Xeon Processors, 8GB RAM WinXP SP2
HP 6005 Pro AMD Athalon X2 B24 3.0Ghz Processor, 4GB RAM Win8 Pro
HP Compaq NC6320 Laptop Intel Core2Duo 2.0Ghz Processor 3GB RAM Win7 Ult
Dell Latitude E4310 Laptop Intel i5 2.67Ghz Processor 4GB RAM Win7 Pro x32

Audio Interfaces: Terratec EWS88MT PCI (2), Audiobox 1818VSL USB & FP10 Firewire, Steinberg MI4 USB, Line 6 Toneport GX & PodXT, Roland GS-10, NI Rig Kontrol 3

Monitors: Yamaha HS50M's

DAWS/VST Hosts: S1 Professional, Plogue Bidule, Xlutop Chainer, Sieb VSTHost & Savihost

Hardware Synthesizers: Roland SH-32 & XV-3080 RedSound Darkstar XP2, Novation X-Station, Yamaha AN200, M-Audio Venom

Hardware Controllers: JL Cooper CS-10 Control Surface, Yamaha EZ-EG, Dillion Les Paul style acoustic electric guitar with Roland GK-3 pickup and GI-20 converter.

The Rest: Guitars, Amps, Stompboxes, Mics, Outboard Gear, VST plugins...too much to list!
[WWW]
mepstein
Presonic

Joined: 23/03/2011 23:22:52
Messages: 267
Location: Plymouth Meeting, PA
Offline

infinitoar wrote:
Audacity isn't a DAW

To be fair, no software package by itself can be a DAW, but to say Audacity (coupled with a PC) isn't I guess that depends on your definition of a DAW. It seems to meet the Wikipedia definition as much as any other.
CPhoenix
Presonoid

Joined: 13/03/2011 00:11:38
Messages: 1993
Location: North Jersey
Offline

The level of retardness in this post is awe-inspiring.
Win 8.1 x64 // i7 3930K (@ 4.2GHz) // Samsung Pro 512GB // 500GB SSD (via Raid 0) // 2TB HD // 32GB RAM // Antec Kuhler 620 // Radeon HD 7870 + Radeon 5450 // MSI X79a GD45 Plus mobo// TI chipset Firewire card

DAW(s): Studio One v2.6 // Maschine Studio // Reason 7 via Rewire
Plugs: UAD 2 Quad, Softube CL 1b, Klanghelm, Toneboosters, Soundtoys, Slate VTM, Kramer Tape
Instr.: Addictive Drums, Gladiator2, Sylenth, AAS Bundle, K9U, IK Total Studio 3, Cinesamples, RealGuitar/Strat/LPC, Trilian

RME UCX // AKG c214 // SM57 + Cloudlifter CL1 // JBL LSR 4328p // FMR RNLA // Korg Kaossilator Pro // Novation 61 SL MKii // Korg MicroKey 25 // Presonus Faderport // Contour Designs Shuttle Pro

Next up: Motif XS rack
[WWW]
LMike
Baconator
[Avatar]

Joined: 19/02/2011 12:02:34
Messages: 8233
Offline

CPhoenix wrote:The level of retardness in this post is awe-inspiring.

What's more amazing is how the scene of a drive by shooting can remain at the top of the forum for many days after the shooter is long gone.

Draw a chalk mark around the body, let the coroner take some photos, wash down the bloody sidewalk with a water hose, move on.

P.S. Thank you for the information kind sir.

This message was edited 1 time. Last update was at 31/05/2013 18:09:28

Studio One Tips For Newbs

"So.... Bitwig. I wonder what's queued up next in line on the drama list?"
 
Forum Index » Studio One General Discussion
Go to: